Lineage for d1an2a_ (1an2 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996289Fold a.38: HLH-like [47458] (2 superfamilies)
    4-helices; bundle, closed, left-handed twist; 2 crossover connections
  4. 1996290Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (2 families) (S)
    dimer of two identical helix-loop-helix subunits
  5. 1996291Family a.38.1.1: HLH, helix-loop-helix DNA-binding domain [47460] (8 proteins)
  6. 1996296Protein Max protein [47461] (2 species)
    BHLHZ region; contains leucine-zipper motif
  7. 1996306Species Mouse (Mus musculus) [TaxId:10090] [47463] (1 PDB entry)
  8. 1996307Domain d1an2a_: 1an2 A: [17130]
    protein/DNA complex

Details for d1an2a_

PDB Entry: 1an2 (more details), 2.9 Å

PDB Description: recognition by max of its cognate dna through a dimeric b/hlh/z domain
PDB Compounds: (A:) protein (transcription factor max (tf max))

SCOPe Domain Sequences for d1an2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1an2a_ a.38.1.1 (A:) Max protein {Mouse (Mus musculus) [TaxId: 10090]}
adkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknhth
qqdiddlkrqnalleqqvralekars

SCOPe Domain Coordinates for d1an2a_:

Click to download the PDB-style file with coordinates for d1an2a_.
(The format of our PDB-style files is described here.)

Timeline for d1an2a_: