SCOPe 2.06: Domain d2zkob_: 2zko B:

Lineage for d2zkob_ (2zko B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families)

5. Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins)

6. Protein automated matches [190929] (6 species)
   not a true protein

7. Species Influenza A virus [TaxId:11320] [188439] (2 PDB entries)

8. Domain d2zkob_: 2zko B: [171290]
   automated match to d1aila_
   protein/RNA complex; complexed with gol

Details for d2zkob_

PDB Entry: 2zko, 1.7 Å

PDB Description: Structural basis for dsRNA recognition by NS1 protein of human influenza virus A

PDB Compounds: (B:) Non-structural protein 1

SCOPe Domain Sequences for d2zkob_:

Sequence; same for both SEQRES and ATOM records:

>d2zkob_ a.16.1.1 (B:) automated matches {Influenza A virus [TaxId: 11320]}
mdpntvssfqvdcflwhvrkrvadqelgdapfldrlrrdqkslrgrgstlgldietatra
gkqiverilk

Timeline for d2zkob_:

• d2zkob_ first appeared in SCOPe 2.01
  
• d2zkob_ appears in SCOPe 2.05
  
• d2zkob_ appears in SCOPe 2.07
  
• d2zkob_ appears in the current release, SCOPe 2.08