| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) ![]() |
| Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins) |
| Protein automated matches [190929] (3 species) not a true protein |
| Species Influenza A virus [TaxId:11320] [188439] (2 PDB entries) |
| Domain d2zkob_: 2zko B: [171290] automated match to d1aila_ protein/RNA complex; complexed with gol |
PDB Entry: 2zko (more details), 1.7 Å
SCOPe Domain Sequences for d2zkob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zkob_ a.16.1.1 (B:) automated matches {Influenza A virus [TaxId: 11320]}
mdpntvssfqvdcflwhvrkrvadqelgdapfldrlrrdqkslrgrgstlgldietatra
gkqiverilk
Timeline for d2zkob_: