Lineage for d2zkoa_ (2zko A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311085Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 2311086Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) (S)
  5. 2311087Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins)
  6. 2311100Protein automated matches [190929] (8 species)
    not a true protein
  7. 2311126Species Influenza A virus, different strains [TaxId:11320] [188439] (2 PDB entries)
  8. 2311131Domain d2zkoa_: 2zko A: [171289]
    automated match to d1aila_
    protein/RNA complex; complexed with gol

Details for d2zkoa_

PDB Entry: 2zko (more details), 1.7 Å

PDB Description: Structural basis for dsRNA recognition by NS1 protein of human influenza virus A
PDB Compounds: (A:) Non-structural protein 1

SCOPe Domain Sequences for d2zkoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zkoa_ a.16.1.1 (A:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
mdpntvssfqvdcflwhvrkrvadqelgdapfldrlrrdqkslrgrgstlgldietatra
gkqiverilk

SCOPe Domain Coordinates for d2zkoa_:

Click to download the PDB-style file with coordinates for d2zkoa_.
(The format of our PDB-style files is described here.)

Timeline for d2zkoa_: