![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
![]() | Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) ![]() |
![]() | Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins) |
![]() | Protein automated matches [190929] (5 species) not a true protein |
![]() | Species Influenza A virus, different strains [TaxId:11320] [188439] (2 PDB entries) |
![]() | Domain d2zkoa_: 2zko A: [171289] automated match to d1aila_ protein/RNA complex; complexed with gol |
PDB Entry: 2zko (more details), 1.7 Å
SCOPe Domain Sequences for d2zkoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zkoa_ a.16.1.1 (A:) automated matches {Influenza A virus, different strains [TaxId: 11320]} mdpntvssfqvdcflwhvrkrvadqelgdapfldrlrrdqkslrgrgstlgldietatra gkqiverilk
Timeline for d2zkoa_: