![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.37: A DNA-binding domain in eukaryotic transcription factors [47453] (1 superfamily) 4 helices; the long C-terminal helix protrudes from the domain and binds to DNA |
![]() | Superfamily a.37.1: A DNA-binding domain in eukaryotic transcription factors [47454] (1 family) ![]() |
![]() | Family a.37.1.1: A DNA-binding domain in eukaryotic transcription factors [47455] (2 proteins) |
![]() | Protein Skn-1 [47456] (1 species) |
![]() | Species Nematode (Caenorhabditis elegans) [TaxId:6239] [47457] (1 PDB entry) |
![]() | Domain d1sknp_: 1skn P: [17127] protein/DNA complex; complexed with lda |
PDB Entry: 1skn (more details), 2.5 Å
SCOPe Domain Sequences for d1sknp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sknp_ a.37.1.1 (P:) Skn-1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} grqskdeqlasdnelpvsafqisemslselqqvlkneslseyqrqlirkirrrgknkvaa rtcrqrrtdrhdkm
Timeline for d1sknp_: