Lineage for d1sknp_ (1skn P:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709979Fold a.37: A DNA-binding domain in eukaryotic transcription factors [47453] (1 superfamily)
    4 helices; the long C-terminal helix protrudes from the domain and binds to DNA
  4. 2709980Superfamily a.37.1: A DNA-binding domain in eukaryotic transcription factors [47454] (1 family) (S)
  5. 2709981Family a.37.1.1: A DNA-binding domain in eukaryotic transcription factors [47455] (2 proteins)
  6. 2709985Protein Skn-1 [47456] (1 species)
  7. 2709986Species Nematode (Caenorhabditis elegans) [TaxId:6239] [47457] (1 PDB entry)
  8. 2709987Domain d1sknp_: 1skn P: [17127]
    protein/DNA complex; complexed with lda

Details for d1sknp_

PDB Entry: 1skn (more details), 2.5 Å

PDB Description: the binding domain of skn-1 in complex with dna: a new dna-binding motif
PDB Compounds: (P:) DNA-binding domain of skn-1

SCOPe Domain Sequences for d1sknp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sknp_ a.37.1.1 (P:) Skn-1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
grqskdeqlasdnelpvsafqisemslselqqvlkneslseyqrqlirkirrrgknkvaa
rtcrqrrtdrhdkm

SCOPe Domain Coordinates for d1sknp_:

Click to download the PDB-style file with coordinates for d1sknp_.
(The format of our PDB-style files is described here.)

Timeline for d1sknp_: