SCOPe 2.06: Domain d2zjwa_: 2zjw A:

Lineage for d2zjwa_ (2zjw A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (653 PDB entries)

8. Domain d2zjwa_: 2zjw A: [171262]
   automated match to d1jwha_
   complexed with ref

Details for d2zjwa_

PDB Entry: 2zjw, 2.4 Å

PDB Description: Crystal structure of human CK2 alpha complexed with Ellagic acid

PDB Compounds: (A:) Casein kinase II subunit alpha

SCOPe Domain Sequences for d2zjwa_:

Sequence; same for both SEQRES and ATOM records:

>d2zjwa_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainit
nnekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntd
fkqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglae
fyhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnyd
qlvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdf
ldkllrydhqsrltareamehpyfytvvkdqa

Timeline for d2zjwa_:

• d2zjwa_ first appeared in SCOPe 2.01
  
• d2zjwa_ appears in SCOPe 2.05
  
• d2zjwa_ appears in SCOPe 2.07
  
• d2zjwa_ appears in the current release, SCOPe 2.08