Lineage for d1qb2b_ (1qb2 B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. Fold a.36: Signal peptide-binding domain [47445] (1 superfamily)
  4. Superfamily a.36.1: Signal peptide-binding domain [47446] (1 family) (S)
  5. Family a.36.1.1: Signal peptide-binding domain [47447] (2 proteins)
  6. Protein SRP54M [47451] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [47452] (1 PDB entry)
  8. Domain d1qb2b_: 1qb2 B: [17126]

Details for d1qb2b_

PDB Entry: 1qb2 (more details), 2.1 Å

PDB Description: crystal structure of the conserved subdomain of human protein srp54m at 2.1a resolution: evidence for the mechanism of signal peptide binding

SCOP Domain Sequences for d1qb2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qb2b_ a.36.1.1 (B:) SRP54M {Human (Homo sapiens)}
qftlrdmyeqfqnimkmgpfsqilgmipgfgtdfmskgneqesmarlkklmtimdsmndq
eldstdgakvfskqpgriqrvargsgvstrdvqelltqytkfaqmvkkm

SCOP Domain Coordinates for d1qb2b_ are not available.

Timeline for d1qb2b_:

Domains from other chains:
(mouse over for more information)
d1qb2a_