SCOPe 2.08: Domain d2zjua1: 2zju A:2-206

Lineage for d2zjua1 (2zju A:2-206)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
   automatically mapped to Pfam PF02931

6. Protein automated matches [190922] (2 species)
   not a true protein

7. Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (38 PDB entries)

8. Domain d2zjua1: 2zju A:2-206 [171252]
   Other proteins in same PDB: d2zjua2, d2zjub2, d2zjuc2, d2zjud2, d2zjue2
   automated match to d1uw6a_
   complexed with im4

Details for d2zjua1

PDB Entry: 2zju, 2.58 Å

PDB Description: crystal structure of lymnaea stagnalis acetylcholine binding protein (ls-achbp) complexed with imidacloprid

PDB Compounds: (A:) acetylcholine-binding protein

SCOPe Domain Sequences for d2zjua1:

Sequence; same for both SEQRES and ATOM records:

>d2zjua1 b.96.1.1 (A:2-206) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
dradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsdr
tlawdsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqrf
scdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkkn
svtysccpeayedvevslnfrkkgr

Timeline for d2zjua1:

• d2zjua1 first appeared in SCOPe 2.01, called d2zjua_
  
• d2zjua1 appears in SCOPe 2.07