Lineage for d2zjcc_ (2zjc C:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1117451Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 1117452Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 1117453Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 1117648Protein Tumor necrosis factor (TNF) [49848] (2 species)
  7. 1117649Species Human (Homo sapiens) [TaxId:9606] [49849] (10 PDB entries)
  8. 1117659Domain d2zjcc_: 2zjc C: [171245]
    automated match to d1a8ma_
    complexed with gol; mutant

Details for d2zjcc_

PDB Entry: 2zjc (more details), 2.5 Å

PDB Description: tnfr1 selectve tnf mutant; r1-6
PDB Compounds: (C:) Tumor necrosis factor

SCOPe Domain Sequences for d2zjcc_:

Sequence, based on SEQRES records: (download)

>d2zjcc_ b.22.1.1 (C:) Tumor necrosis factor (TNF) {Human (Homo sapiens) [TaxId: 9606]}
psdmpvahvvanpqaegqlqwknaganallangvelrdnqlvvpseglyliysqvlfsgq
gcpsthvllthtisriavsyqtpvnllsairspcqretpegaeanpwyepiylggvfqle
pgdrlsaeinrpdyldfastgqvyfgiial

Sequence, based on observed residues (ATOM records): (download)

>d2zjcc_ b.22.1.1 (C:) Tumor necrosis factor (TNF) {Human (Homo sapiens) [TaxId: 9606]}
psdmpvahvvanpqaegqlqwknaganallangvelrdnqlvvpseglyliysqvlfsgq
gcpsthvllthtisriavsyqtpvnllsairspcqanpwyepiylggvfqlepgdrlsae
inrpdyldfastgqvyfgiial

SCOPe Domain Coordinates for d2zjcc_:

Click to download the PDB-style file with coordinates for d2zjcc_.
(The format of our PDB-style files is described here.)

Timeline for d2zjcc_: