SCOPe 2.01: Domain d2zjcb_: 2zjc B:

Lineage for d2zjcb_ (2zjc B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.1: TNF-like [49843] (15 proteins)

6. Protein Tumor necrosis factor (TNF) [49848] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49849] (10 PDB entries)

8. Domain d2zjcb_: 2zjc B: [171244]
   automated match to d1a8ma_
   complexed with gol; mutant

Details for d2zjcb_

PDB Entry: 2zjc, 2.5 Å

PDB Description: tnfr1 selectve tnf mutant; r1-6

PDB Compounds: (B:) Tumor necrosis factor

SCOPe Domain Sequences for d2zjcb_:

Sequence; same for both SEQRES and ATOM records:

>d2zjcb_ b.22.1.1 (B:) Tumor necrosis factor (TNF) {Human (Homo sapiens) [TaxId: 9606]}
tpsdmpvahvvanpqaegqlqwknaganallangvelrdnqlvvpseglyliysqvlfsg
qgcpsthvllthtisriavsyqtpvnllsairspcqretpegaeanpwyepiylggvfql
epgdrlsaeinrpdyldfastgqvyfgiial

Timeline for d2zjcb_:

• d2zjcb_ is new in SCOPe 2.01-stable
  
• d2zjcb_ appears in SCOPe 2.02
  
• d2zjcb_ appears in the current release, SCOPe 2.08