SCOP 1.55: Domain d2ffhc2: 2ffh C:319-418

Lineage for d2ffhc2 (2ffh C:319-418)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.36: Signal peptide-binding domain [47445] (1 superfamily)
4. Superfamily a.36.1: Signal peptide-binding domain [47446] (1 family)
5. Family a.36.1.1: Signal peptide-binding domain [47447] (2 proteins)
6. Protein Signal sequence binding protein Ffh [47448] (2 species)

7. Species Thermus aquaticus [TaxId:271] [47450] (1 PDB entry)

8. Domain d2ffhc2: 2ffh C:319-418 [17124]
   Other proteins in same PDB: d2ffha1, d2ffha3, d2ffhb1, d2ffhb3, d2ffhc1, d2ffhc3

Details for d2ffhc2

PDB Entry: 2ffh, 3.2 Å

PDB Description: the signal sequence binding protein ffh from thermus aquaticus

SCOP Domain Sequences for d2ffhc2:

Sequence; same for both SEQRES and ATOM records:

>d2ffhc2 a.36.1.1 (C:319-418) Signal sequence binding protein Ffh {Thermus aquaticus}
elsledflkqmqnlkrlgpfseilgllpgvpqglkvdekaikrleaivlsmtpeerkdpr
ilngsrrkriakgsgtsvqevnrfikafeemkalmkslek

Timeline for d2ffhc2:

• d2ffhc2 appears in SCOP 1.57
  
• d2ffhc2 appears in the current release, SCOPe 2.08