Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins) duplication: consists of two clear structural repeats each having this fold subunit fold and dimeric assembly are similar to those of glyoxalase |
Protein automated matches [190190] (5 species) not a true protein |
Species Streptoalloteichus hindustanus [TaxId:2017] [188784] (1 PDB entry) |
Domain d2zhpa_: 2zhp A: [171235] automated match to d1byla_ complexed with by6, cl, cu |
PDB Entry: 2zhp (more details), 1.6 Å
SCOPe Domain Sequences for d2zhpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zhpa_ d.32.1.2 (A:) automated matches {Streptoalloteichus hindustanus [TaxId: 2017]} akltsavpvltardvagavefwtdrlgfsrdfveddfagvvrddvtlfisavqdqvvpdn tlawvwvrgldelyaewsevvstnfrdasgpamteigeqpwgrefalrdpagncvhfvae
Timeline for d2zhpa_: