SCOPe 2.05: Domain d2zhpa_: 2zhp A:

Lineage for d2zhpa_ (2zhp A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins)
   duplication: consists of two clear structural repeats each having this fold
   subunit fold and dimeric assembly are similar to those of glyoxalase

6. Protein automated matches [190190] (5 species)
   not a true protein

7. Species Streptoalloteichus hindustanus [TaxId:2017] [188784] (1 PDB entry)

8. Domain d2zhpa_: 2zhp A: [171235]
   automated match to d1byla_
   complexed with by6, cl, cu

Details for d2zhpa_

PDB Entry: 2zhp, 1.6 Å

PDB Description: Crystal structure of bleomycin-binding protein from Streptoalloteichus hindustanus complexed with bleomycin derivative

PDB Compounds: (A:) bleomycin resistance protein

SCOPe Domain Sequences for d2zhpa_:

Sequence; same for both SEQRES and ATOM records:

>d2zhpa_ d.32.1.2 (A:) automated matches {Streptoalloteichus hindustanus [TaxId: 2017]}
akltsavpvltardvagavefwtdrlgfsrdfveddfagvvrddvtlfisavqdqvvpdn
tlawvwvrgldelyaewsevvstnfrdasgpamteigeqpwgrefalrdpagncvhfvae

Timeline for d2zhpa_:

• d2zhpa_ first appeared in SCOPe 2.01
  
• d2zhpa_ appears in SCOPe 2.04
  
• d2zhpa_ appears in SCOPe 2.06
  
• d2zhpa_ appears in the current release, SCOPe 2.08