SCOPe 2.05: Domain d2zhmc_: 2zhm C:

Lineage for d2zhmc_ (2zhm C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187655] (48 PDB entries)

8. Domain d2zhmc_: 2zhm C: [171232]
   automated match to d1a3ka_
   complexed with rpn

Details for d2zhmc_

PDB Entry: 2zhm, 1.84 Å

PDB Description: crystal structure of human galectin-9 n-terminal crd in complex with n-acetyllactosamine trimer (crystal 1)

PDB Compounds: (C:) Galectin-9

SCOPe Domain Sequences for d2zhmc_:

Sequence; same for both SEQRES and ATOM records:

>d2zhmc_ b.29.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiafhfnprf
edggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfvqyfhrv
pfhrvdtisvngsvqlsyisfq

Timeline for d2zhmc_:

• d2zhmc_ first appeared in SCOPe 2.01
  
• d2zhmc_ appears in SCOPe 2.04
  
• d2zhmc_ appears in SCOPe 2.06
  
• d2zhmc_ appears in the current release, SCOPe 2.08