Lineage for d2zhmb_ (2zhm B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781809Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1781810Protein automated matches [190437] (37 species)
    not a true protein
  7. 1781960Species Human (Homo sapiens) [TaxId:9606] [187655] (48 PDB entries)
  8. 1781979Domain d2zhmb_: 2zhm B: [171231]
    automated match to d1a3ka_
    complexed with rpn

Details for d2zhmb_

PDB Entry: 2zhm (more details), 1.84 Å

PDB Description: crystal structure of human galectin-9 n-terminal crd in complex with n-acetyllactosamine trimer (crystal 1)
PDB Compounds: (B:) Galectin-9

SCOPe Domain Sequences for d2zhmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zhmb_ b.29.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiafhfnprf
edggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfvqyfhrv
pfhrvdtisvngsvqlsyisfq

SCOPe Domain Coordinates for d2zhmb_:

Click to download the PDB-style file with coordinates for d2zhmb_.
(The format of our PDB-style files is described here.)

Timeline for d2zhmb_: