Lineage for d2ffhb2 (2ffh B:319-418)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768356Fold a.36: Signal peptide-binding domain [47445] (1 superfamily)
    4 helices; orthogonal array
  4. 768357Superfamily a.36.1: Signal peptide-binding domain [47446] (1 family) (S)
  5. 768358Family a.36.1.1: Signal peptide-binding domain [47447] (2 proteins)
  6. 768359Protein Signal sequence binding protein Ffh [47448] (3 species)
  7. 768381Species Thermus aquaticus [TaxId:271] [47450] (1 PDB entry)
  8. 768383Domain d2ffhb2: 2ffh B:319-418 [17123]
    Other proteins in same PDB: d2ffha1, d2ffha3, d2ffhb1, d2ffhb3, d2ffhc1, d2ffhc3

Details for d2ffhb2

PDB Entry: 2ffh (more details), 3.2 Å

PDB Description: the signal sequence binding protein ffh from thermus aquaticus
PDB Compounds: (B:) protein (ffh)

SCOP Domain Sequences for d2ffhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ffhb2 a.36.1.1 (B:319-418) Signal sequence binding protein Ffh {Thermus aquaticus [TaxId: 271]}
elsledflkqmqnlkrlgpfseilgllpgvpqglkvdekaikrleaivlsmtpeerkdpr
ilngsrrkriakgsgtsvqevnrfikafeemkalmkslek

SCOP Domain Coordinates for d2ffhb2:

Click to download the PDB-style file with coordinates for d2ffhb2.
(The format of our PDB-style files is described here.)

Timeline for d2ffhb2: