![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.36: Signal peptide-binding domain [47445] (1 superfamily) 4 helices; orthogonal array |
![]() | Superfamily a.36.1: Signal peptide-binding domain [47446] (2 families) ![]() |
![]() | Family a.36.1.1: Signal peptide-binding domain [47447] (2 proteins) |
![]() | Protein Signal sequence binding protein Ffh [47448] (3 species) |
![]() | Species Thermus aquaticus [TaxId:271] [47450] (1 PDB entry) |
![]() | Domain d2ffhb2: 2ffh B:319-418 [17123] Other proteins in same PDB: d2ffha1, d2ffha3, d2ffhb1, d2ffhb3, d2ffhc1, d2ffhc3 complexed with cd, so4 |
PDB Entry: 2ffh (more details), 3.2 Å
SCOPe Domain Sequences for d2ffhb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ffhb2 a.36.1.1 (B:319-418) Signal sequence binding protein Ffh {Thermus aquaticus [TaxId: 271]} elsledflkqmqnlkrlgpfseilgllpgvpqglkvdekaikrleaivlsmtpeerkdpr ilngsrrkriakgsgtsvqevnrfikafeemkalmkslek
Timeline for d2ffhb2: