Lineage for d2zhlc_ (2zhl C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2375103Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2375104Protein automated matches [190437] (55 species)
    not a true protein
  7. 2375328Species Human (Homo sapiens) [TaxId:9606] [187655] (81 PDB entries)
  8. 2375347Domain d2zhlc_: 2zhl C: [171228]
    automated match to d1a3ka_

Details for d2zhlc_

PDB Entry: 2zhl (more details), 1.75 Å

PDB Description: Crystal structure of human galectin-9 N-terminal CRD in complex with N-acetyllactosamine dimer (crystal 2)
PDB Compounds: (C:) Galectin-9

SCOPe Domain Sequences for d2zhlc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zhlc_ b.29.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiafhfnprf
edggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfvqyfhrv
pfhrvdtisvngsvqlsyisfq

SCOPe Domain Coordinates for d2zhlc_:

Click to download the PDB-style file with coordinates for d2zhlc_.
(The format of our PDB-style files is described here.)

Timeline for d2zhlc_: