Lineage for d2zhka_ (2zhk A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1118105Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1118106Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1119701Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1119702Protein automated matches [190437] (13 species)
    not a true protein
  7. 1119732Species Human (Homo sapiens) [TaxId:9606] [187655] (25 PDB entries)
  8. 1119751Domain d2zhka_: 2zhk A: [171224]
    automated match to d1a3ka_

Details for d2zhka_

PDB Entry: 2zhk (more details), 1.8 Å

PDB Description: crystal structure of human galectin-9 n-terminal crd in complex with n-acetyllactosamine dimer (crystal 1)
PDB Compounds: (A:) Galectin-9

SCOPe Domain Sequences for d2zhka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zhka_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiafhfnprf
edggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfvqyfhrv
pfhrvdtisvngsvqlsyisf

SCOPe Domain Coordinates for d2zhka_:

Click to download the PDB-style file with coordinates for d2zhka_.
(The format of our PDB-style files is described here.)

Timeline for d2zhka_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2zhkb_