SCOPe 2.08: Domain d2zhka_: 2zhk A:

Lineage for d2zhka_ (2zhk A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187655] (109 PDB entries)

8. Domain d2zhka_: 2zhk A: [171224]
   automated match to d1a3ka_

Details for d2zhka_

PDB Entry: 2zhk, 1.8 Å

PDB Description: crystal structure of human galectin-9 n-terminal crd in complex with n-acetyllactosamine dimer (crystal 1)

PDB Compounds: (A:) Galectin-9

SCOPe Domain Sequences for d2zhka_:

Sequence; same for both SEQRES and ATOM records:

>d2zhka_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiafhfnprf
edggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfvqyfhrv
pfhrvdtisvngsvqlsyisf

Timeline for d2zhka_:

• d2zhka_ first appeared in SCOPe 2.01
  
• d2zhka_ appears in SCOPe 2.07