Lineage for d2zhja_ (2zhj A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1738953Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 1738954Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 1738955Family a.65.1.1: Annexin [47875] (10 proteins)
  6. 1739054Protein automated matches [190368] (3 species)
    not a true protein
  7. 1739062Species Norway rat (Rattus norvegicus) [TaxId:10116] [188544] (2 PDB entries)
  8. 1739063Domain d2zhja_: 2zhj A: [171223]
    automated match to d1anna_
    complexed with na

Details for d2zhja_

PDB Entry: 2zhj (more details), 1.35 Å

PDB Description: Crystal Structure Analysis of the Sodium-Bound Annexin A4 at 1.34 A resolution
PDB Compounds: (A:) Annexin A4

SCOPe Domain Sequences for d2zhja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zhja_ a.65.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
etkggtvkaasgfnatedaqvlrkamkglgtdedaiigvlacrntaqrqeirtaykstig
rdlledlkselssnfeqvilgmmtptvlydvqelrramkgagtdegclieilasrnpeei
rrinqtyqqqygrsleedicsdtsfmfqrvlvsltaggrdegnylddalvkqdaqdlyea
gekrwgtdevkflsilcsrnrnhllhvfdeykrisqkdieqsiksetsgsfedallaivk
cmrnkpayfaerlyksmkglgtddstlirvmvsraeidmldiranfkrlygkslysfikg
dtsgdyrkvllilcg

SCOPe Domain Coordinates for d2zhja_:

Click to download the PDB-style file with coordinates for d2zhja_.
(The format of our PDB-style files is described here.)

Timeline for d2zhja_: