Lineage for d2zhia_ (2zhi A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717085Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2717086Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2717087Family a.65.1.1: Annexin [47875] (10 proteins)
  6. 2717186Protein automated matches [190368] (3 species)
    not a true protein
  7. 2717202Species Norway rat (Rattus norvegicus) [TaxId:10116] [188544] (2 PDB entries)
  8. 2717204Domain d2zhia_: 2zhi A: [171222]
    automated match to d1anna_
    complexed with na, so4

Details for d2zhia_

PDB Entry: 2zhi (more details), 1.58 Å

PDB Description: Crystal Structure Analysis of the Sodium-Bound Annexin A4 at 1.58 A resolution
PDB Compounds: (A:) Annexin A4

SCOPe Domain Sequences for d2zhia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zhia_ a.65.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kggtvkaasgfnatedaqvlrkamkglgtdedaiigvlacrntaqrqeirtaykstigrd
lledlkselssnfeqvilgmmtptvlydvqelrramkgagtdegclieilasrnpeeirr
inqtyqqqygrsleedicsdtsfmfqrvlvsltaggrdegnylddalvkqdaqdlyeage
krwgtdevkflsilcsrnrnhllhvfdeykrisqkdieqsiksetsgsfedallaivkcm
rnkpayfaerlyksmkglgtddstlirvmvsraeidmldiranfkrlygkslysfikgdt
sgdyrkvllilcggd

SCOPe Domain Coordinates for d2zhia_:

Click to download the PDB-style file with coordinates for d2zhia_.
(The format of our PDB-style files is described here.)

Timeline for d2zhia_: