Lineage for d1dula_ (1dul A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 280737Fold a.36: Signal peptide-binding domain [47445] (1 superfamily)
    4 helices; orthogonal array
  4. 280738Superfamily a.36.1: Signal peptide-binding domain [47446] (1 family) (S)
  5. 280739Family a.36.1.1: Signal peptide-binding domain [47447] (2 proteins)
  6. 280740Protein Signal sequence binding protein Ffh [47448] (2 species)
  7. 280741Species Escherichia coli [TaxId:562] [47449] (2 PDB entries)
  8. 280743Domain d1dula_: 1dul A: [17121]
    protein/RNA complex; complexed with ccc, k, mg; mutant

Details for d1dula_

PDB Entry: 1dul (more details), 1.8 Å

PDB Description: structure of the ribonucleoprotein core of the e. coli signal recognition particle

SCOP Domain Sequences for d1dula_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dula_ a.36.1.1 (A:) Signal sequence binding protein Ffh {Escherichia coli}
fdlndfleqkvlvrmeaiinsmtmkerakpeiikgsrkrriaagsgmqvqdvnrllkqfd
dmqrmmkkm

SCOP Domain Coordinates for d1dula_:

Click to download the PDB-style file with coordinates for d1dula_.
(The format of our PDB-style files is described here.)

Timeline for d1dula_: