Lineage for d2zgja_ (2zgj A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2390288Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2390289Protein automated matches [190438] (28 species)
    not a true protein
  7. 2390333Species Human (Homo sapiens) [TaxId:9606] [187421] (76 PDB entries)
  8. 2390366Domain d2zgja_: 2zgj A: [171207]
    automated match to d1dsta_
    complexed with so4

Details for d2zgja_

PDB Entry: 2zgj (more details), 2.3 Å

PDB Description: Crystal Structure of D86N-GzmM Complexed with Its Optimal Synthesized Substrate
PDB Compounds: (A:) Granzyme M

SCOPe Domain Sequences for d2zgja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zgja_ b.47.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iiggreviphsrpymaslqrngshlcggvlvhpkwvltaahclaqrmaqlrlvlglhtld
spgltfhikaaiqhprykpvpalennlallqldgkvkpsrtirplalpskrqvvaagtrc
smagwglthqggrlsrvlreldlqvldtrmcnnsrfwngslspsmvclaadskdqapckg
dsggplvcgkgrvlagvlsfssrvctdifkppvatavapyvswirkvtgrs

SCOPe Domain Coordinates for d2zgja_:

Click to download the PDB-style file with coordinates for d2zgja_.
(The format of our PDB-style files is described here.)

Timeline for d2zgja_: