SCOPe 2.01: Domain d1hq1a_: 1hq1 A:

Lineage for d1hq1a_ (1hq1 A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.36: Signal peptide-binding domain [47445] (1 superfamily)
   4 helices; orthogonal array

4. Superfamily a.36.1: Signal peptide-binding domain [47446] (1 family)

5. Family a.36.1.1: Signal peptide-binding domain [47447] (3 proteins)

6. Protein Signal sequence binding protein Ffh [47448] (3 species)

7. Species Escherichia coli [TaxId:562] [47449] (13 PDB entries)

8. Domain d1hq1a_: 1hq1 A: [17120]
   protein/RNA complex; complexed with k, mg

Details for d1hq1a_

PDB Entry: 1hq1, 1.52 Å

PDB Description: structural and energetic analysis of rna recognition by a universally conserved protein from the signal recognition particle

PDB Compounds: (A:) signal recognition particle protein

SCOPe Domain Sequences for d1hq1a_:

Sequence, based on SEQRES records:

>d1hq1a_ a.36.1.1 (A:) Signal sequence binding protein Ffh {Escherichia coli [TaxId: 562]}
gfdlndfleqlrqmknmggmaslmgklpgmgqipdnvksqmddkvlvrmeaiinsmtmke
rakpeiikgsrkrriaagsgmqvqdvnrllkqfddmqrmmkkmk

Sequence, based on observed residues (ATOM records):

>d1hq1a_ a.36.1.1 (A:) Signal sequence binding protein Ffh {Escherichia coli [TaxId: 562]}
gfdlndfleqlrqddkvlvrmeaiinsmtmkerakpeiikgsrkrriaagsgmqvqdvnr
llkqfddmqrmmkkmk

Timeline for d1hq1a_:

• d1hq1a_ first appeared (with stable ids) in SCOP 1.55
  
• d1hq1a_ appears in SCOP 1.75
  
• d1hq1a_ appears in SCOPe 2.02
  
• d1hq1a_ appears in the current release, SCOPe 2.08