Lineage for d1hq1a_ (1hq1 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319315Fold a.36: Signal peptide-binding domain [47445] (1 superfamily)
    4 helices; orthogonal array
  4. 2319316Superfamily a.36.1: Signal peptide-binding domain [47446] (2 families) (S)
  5. 2319317Family a.36.1.1: Signal peptide-binding domain [47447] (2 protein domains)
  6. 2319318Protein Signal sequence binding protein Ffh [47448] (3 species)
  7. 2319319Species Escherichia coli [TaxId:562] [47449] (14 PDB entries)
  8. 2319320Domain d1hq1a_: 1hq1 A: [17120]
    protein/RNA complex; complexed with k, mg

Details for d1hq1a_

PDB Entry: 1hq1 (more details), 1.52 Å

PDB Description: structural and energetic analysis of rna recognition by a universally conserved protein from the signal recognition particle
PDB Compounds: (A:) signal recognition particle protein

SCOPe Domain Sequences for d1hq1a_:

Sequence, based on SEQRES records: (download)

>d1hq1a_ a.36.1.1 (A:) Signal sequence binding protein Ffh {Escherichia coli [TaxId: 562]}
gfdlndfleqlrqmknmggmaslmgklpgmgqipdnvksqmddkvlvrmeaiinsmtmke
rakpeiikgsrkrriaagsgmqvqdvnrllkqfddmqrmmkkmk

Sequence, based on observed residues (ATOM records): (download)

>d1hq1a_ a.36.1.1 (A:) Signal sequence binding protein Ffh {Escherichia coli [TaxId: 562]}
gfdlndfleqlrqddkvlvrmeaiinsmtmkerakpeiikgsrkrriaagsgmqvqdvnr
llkqfddmqrmmkkmk

SCOPe Domain Coordinates for d1hq1a_:

Click to download the PDB-style file with coordinates for d1hq1a_.
(The format of our PDB-style files is described here.)

Timeline for d1hq1a_: