Lineage for d2zfob_ (2zfo B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2689395Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 2689396Protein automated matches [190590] (26 species)
    not a true protein
  7. 2689508Species Oligobrachia mashikoi [TaxId:55676] [187601] (8 PDB entries)
  8. 2689514Domain d2zfob_: 2zfo B: [171195]
    automated match to d1x9fb_
    complexed with gol, hem, oxy

Details for d2zfob_

PDB Entry: 2zfo (more details), 1.95 Å

PDB Description: Structure of the partially unliganded met state of 400 kDa hemoglobin: Insights into ligand-induced structural changes of giant hemoglobins
PDB Compounds: (B:) Extracellular giant hemoglobin major globin subunit A2

SCOPe Domain Sequences for d2zfob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zfob_ a.1.1.0 (B:) automated matches {Oligobrachia mashikoi [TaxId: 55676]}
dctslnrllvkrqwaeaygegtnrellgnriwedlfanmpdarglfsrvngndidssefq
ahslrvlggldmcvaslddvpvlnallarlnsqhdsrgipaagypafvasaisavratvg
arsfdndawnscmnqivsgisg

SCOPe Domain Coordinates for d2zfob_:

Click to download the PDB-style file with coordinates for d2zfob_.
(The format of our PDB-style files is described here.)

Timeline for d2zfob_: