Lineage for d2zfoa_ (2zfo A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 904007Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 904008Protein automated matches [190590] (10 species)
    not a true protein
  7. 904032Species Oligobrachia mashikoi [TaxId:55676] [187601] (4 PDB entries)
  8. 904041Domain d2zfoa_: 2zfo A: [171194]
    automated match to d1x9fb_
    complexed with gol, hem, oxy

Details for d2zfoa_

PDB Entry: 2zfo (more details), 1.95 Å

PDB Description: Structure of the partially unliganded met state of 400 kDa hemoglobin: Insights into ligand-induced structural changes of giant hemoglobins
PDB Compounds: (A:) Extracellular giant hemoglobin major globin subunit A1

SCOPe Domain Sequences for d2zfoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zfoa_ a.1.1.0 (A:) automated matches {Oligobrachia mashikoi [TaxId: 55676]}
vcnrleqilvktqwaqsygeaenraafsrdlfselfniqgssralfsgvgvddmnsaaft
ahclrvtgalnrlisqldqqatinadlahlagqhasrnldasnfaamgqavmsvvpthld
cfnqhawgecyeriasgisg

SCOPe Domain Coordinates for d2zfoa_:

Click to download the PDB-style file with coordinates for d2zfoa_.
(The format of our PDB-style files is described here.)

Timeline for d2zfoa_: