Lineage for d1uxc__ (1uxc -)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47323Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
  4. 47324Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families) (S)
  5. 47418Family a.35.1.5: Bacterial repressors [47438] (3 proteins)
  6. 47419Protein Fructose repressor (FruR), N-terminal domain [47443] (1 species)
  7. 47420Species Escherichia coli [TaxId:562] [47444] (2 PDB entries)
  8. 47422Domain d1uxc__: 1uxc - [17119]

Details for d1uxc__

PDB Entry: 1uxc (more details)

PDB Description: fructose repressor dna-binding domain, nmr, minimized structure

SCOP Domain Sequences for d1uxc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uxc__ a.35.1.5 (-) Fructose repressor (FruR), N-terminal domain {Escherichia coli}
mkldeiarlagvsrttasyvingkakqyrvsdktvekvmavvrehnyhpn

SCOP Domain Coordinates for d1uxc__:

Click to download the PDB-style file with coordinates for d1uxc__.
(The format of our PDB-style files is described here.)

Timeline for d1uxc__: