Lineage for d1uxd__ (1uxd -)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families) 
Family a.35.1.5: Bacterial repressors [47438] (3 proteins) 
Protein Fructose repressor (FruR), N-terminal domain [47443] (1 species) Species Escherichia coli [TaxId:562] [47444] (2 PDB entries) 
Domain d1uxd__: 1uxd - [17118]
Details for d1uxd__
PDB Entry: 1uxd (more details)
PDB Description: fructose repressor dna-binding domain, nmr, 34 structures
SCOP Domain Sequences for d1uxd__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uxd__ a.35.1.5 (-) Fructose repressor (FruR), N-terminal domain {Escherichia coli}
mkldeiarlagvsrttasyvingkakqyrvsdktvekvmavvrehnyhpnavaaglrlq
SCOP Domain Coordinates for d1uxd__:
Click to download the PDB-style file with coordinates for d1uxd__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1uxd__:
- d1uxd__ first appeared (with stable ids) in SCOP 1.55
- d1uxd__ appears in SCOP 1.59
- d1uxd__ appears in the current release, SCOPe 2.08, called d1uxda1
View in 3D