Lineage for d2zecd_ (2zec D:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952974Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 952975Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 953177Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 953286Protein beta-Tryptase [50546] (1 species)
    ring-like tetramer with active sites facing a central pore
  7. 953287Species Human (Homo sapiens) [TaxId:9606] [50547] (12 PDB entries)
  8. 953299Domain d2zecd_: 2zec D: [171172]
    automated match to d1a0la_
    complexed with 11n

Details for d2zecd_

PDB Entry: 2zec (more details), 2.06 Å

PDB Description: potent, nonpeptide inhibitors of human mast cell tryptase
PDB Compounds: (D:) Tryptase beta 2

SCOPe Domain Sequences for d2zecd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zecd_ b.47.1.2 (D:) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]}
ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
vpk

SCOPe Domain Coordinates for d2zecd_:

Click to download the PDB-style file with coordinates for d2zecd_.
(The format of our PDB-style files is described here.)

Timeline for d2zecd_: