Lineage for d1lbgd1 (1lbg D:1-60)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709316Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2709317Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2709593Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins)
    lacks the first helix of canonical fold
    3 helices; bundle, partly opened, right-handed twist
  6. 2709609Protein Lac repressor (LacR), N-terminal domain [47441] (1 species)
  7. 2709610Species Escherichia coli [TaxId:562] [47442] (14 PDB entries)
  8. 2709639Domain d1lbgd1: 1lbg D:1-60 [17117]
    Other proteins in same PDB: d1lbga2, d1lbgb2, d1lbgc2, d1lbgd2
    protein/DNA complex

Details for d1lbgd1

PDB Entry: 1lbg (more details), 4.8 Å

PDB Description: lactose operon repressor bound to 21-base pair symmetric operator dna, alpha carbons only
PDB Compounds: (D:) protein (lactose operon repressor)

SCOPe Domain Sequences for d1lbgd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lbgd1 a.35.1.5 (D:1-60) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]}
mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq

SCOPe Domain Coordinates for d1lbgd1:

Click to download the PDB-style file with coordinates for d1lbgd1.
(The format of our PDB-style files is described here.)

Timeline for d1lbgd1: