SCOPe 2.06: Domain d2zebd_: 2zeb D:

Lineage for d2zebd_ (2zeb D:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein beta-Tryptase [50546] (1 species)
   ring-like tetramer with active sites facing a central pore

7. Species Human (Homo sapiens) [TaxId:9606] [50547] (20 PDB entries)

8. Domain d2zebd_: 2zeb D: [171168]
   automated match to d1a0la_
   complexed with 11m

Details for d2zebd_

PDB Entry: 2zeb, 2.5 Å

PDB Description: Potent, Nonpeptide Inhibitors of Human Mast Cell Tryptase

PDB Compounds: (D:) Tryptase beta 2

SCOPe Domain Sequences for d2zebd_:

Sequence; same for both SEQRES and ATOM records:

>d2zebd_ b.47.1.2 (D:) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]}
ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
vpk

Timeline for d2zebd_:

• d2zebd_ first appeared in SCOPe 2.01
  
• d2zebd_ appears in SCOPe 2.05
  
• d2zebd_ appears in SCOPe 2.07
  
• d2zebd_ appears in the current release, SCOPe 2.08