![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
![]() | Family d.58.4.5: PG130-like [102959] (6 proteins) subfamily of Pfam PF03992 |
![]() | Protein automated matches [190959] (1 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:1280] [188570] (1 PDB entry) |
![]() | Domain d2zdoc1: 2zdo C:1-107 [171161] Other proteins in same PDB: d2zdoa2, d2zdob2, d2zdoc2, d2zdod2 automated match to d1xbwa_ complexed with hem |
PDB Entry: 2zdo (more details), 1.8 Å
SCOPe Domain Sequences for d2zdoc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zdoc1 d.58.4.5 (C:1-107) automated matches {Staphylococcus aureus [TaxId: 1280]} mkfmaearltltkgtakdiierfytrhgietlegfdgmfvtqtleqedfdevkiltvwks kqaftdwlksdvfkaahkhvrsknedesspiinnkvitydigysymk
Timeline for d2zdoc1: