SCOPe 2.08: Domain d2zdoc1: 2zdo C:1-107

Lineage for d2zdoc1 (2zdo C:1-107)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.5: PG130-like [102959] (6 proteins)
   subfamily of Pfam PF03992

6. Protein automated matches [190959] (1 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [188570] (1 PDB entry)

8. Domain d2zdoc1: 2zdo C:1-107 [171161]
   Other proteins in same PDB: d2zdoa2, d2zdob2, d2zdoc2, d2zdod2
   automated match to d1xbwa_
   complexed with hem

Details for d2zdoc1

PDB Entry: 2zdo, 1.8 Å

PDB Description: crystal structure of isdg-n7a in complex with hemin

PDB Compounds: (C:) Heme-degrading monooxygenase isdG

SCOPe Domain Sequences for d2zdoc1:

Sequence; same for both SEQRES and ATOM records:

>d2zdoc1 d.58.4.5 (C:1-107) automated matches {Staphylococcus aureus [TaxId: 1280]}
mkfmaearltltkgtakdiierfytrhgietlegfdgmfvtqtleqedfdevkiltvwks
kqaftdwlksdvfkaahkhvrsknedesspiinnkvitydigysymk

Timeline for d2zdoc1:

• d2zdoc1 first appeared in SCOPe 2.01, called d2zdoc_
  
• d2zdoc1 appears in SCOPe 2.07