Lineage for d1lbgc1 (1lbg C:1-60)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 97149Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
  4. 97150Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families) (S)
  5. 97246Family a.35.1.5: Bacterial repressors [47438] (3 proteins)
  6. 97251Protein Lac repressor (LacR), N-terminal domain [47441] (1 species)
  7. 97252Species Escherichia coli [TaxId:562] [47442] (7 PDB entries)
  8. 97265Domain d1lbgc1: 1lbg C:1-60 [17116]
    Other proteins in same PDB: d1lbga2, d1lbgb2, d1lbgc2, d1lbgd2

Details for d1lbgc1

PDB Entry: 1lbg (more details), 4.8 Å

PDB Description: lactose operon repressor bound to 21-base pair symmetric operator dna, alpha carbons only

SCOP Domain Sequences for d1lbgc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lbgc1 a.35.1.5 (C:1-60) Lac repressor (LacR), N-terminal domain {Escherichia coli}
mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq

SCOP Domain Coordinates for d1lbgc1:

Click to download the PDB-style file with coordinates for d1lbgc1.
(The format of our PDB-style files is described here.)

Timeline for d1lbgc1: