SCOPe 2.06: Domain d2zcwa1: 2zcw A:117-198

Lineage for d2zcwa1 (2zcw A:117-198)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins)

6. Protein Transcriptional regulator TTHA1359, C-terminal domain [140233] (1 species)

7. Species Thermus thermophilus [TaxId:274] [140234] (2 PDB entries)
   Uniprot Q5SIL0 118-199

8. Domain d2zcwa1: 2zcw A:117-198 [171157]
   Other proteins in same PDB: d2zcwa2
   complexed with mpd

Details for d2zcwa1

PDB Entry: 2zcw, 1.5 Å

PDB Description: Crystal Structure of TTHA1359, a Transcriptional Regulator, CRP/FNR family from Thermus thermophilus HB8

PDB Compounds: (A:) Transcriptional regulator, FNR/CRP family

SCOPe Domain Sequences for d2zcwa1:

Sequence; same for both SEQRES and ATOM records:

>d2zcwa1 a.4.5.4 (A:117-198) Transcriptional regulator TTHA1359, C-terminal domain {Thermus thermophilus [TaxId: 274]}
rlknrmaaallelsetplaheeegkvvlkathdelaaavgsvretvtkvigelaregyir
sgygkiqlldlkglkelaesrg

Timeline for d2zcwa1:

• d2zcwa1 first appeared in SCOPe 2.01
  
• d2zcwa1 appears in SCOPe 2.05
  
• d2zcwa1 appears in SCOPe 2.07
  
• d2zcwa1 appears in the current release, SCOPe 2.08