SCOPe 2.05: Domain d2zcja_: 2zcj A:

Lineage for d2zcja_ (2zcj A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.26: C5 cytosine-specific DNA methylase, DCM [88786] (5 proteins)
   automatically mapped to Pfam PF00145

6. Protein DNA methylase HhaI [53367] (2 species)

7. Species Haemophilus parahaemolyticus [TaxId:735] [187136] (6 PDB entries)

8. Domain d2zcja_: 2zcj A: [171156]
   automated match to d10mha_
   protein/DNA complex; complexed with sah

Details for d2zcja_

PDB Entry: 2zcj, 2.75 Å

PDB Description: ternary structure of the glu119gln m.hhai, c5-cytosine dna methyltransferase, with unmodified dna and adohcy

PDB Compounds: (A:) modification methylase hhai

SCOPe Domain Sequences for d2zcja_:

Sequence; same for both SEQRES and ATOM records:

>d2zcja_ c.66.1.26 (A:) DNA methylase HhaI {Haemophilus parahaemolyticus [TaxId: 735]}
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmqn
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

Timeline for d2zcja_:

• d2zcja_ first appeared in SCOPe 2.01
  
• d2zcja_ appears in SCOPe 2.04
  
• d2zcja_ appears in SCOPe 2.06
  
• d2zcja_ appears in the current release, SCOPe 2.08