SCOPe 2.07: Domain d2zchp_: 2zch P:

Lineage for d2zchp_ (2zch P:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein automated matches [190044] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187233] (166 PDB entries)

8. Domain d2zchp_: 2zch P: [171155]
   Other proteins in same PDB: d2zchl1, d2zchl2
   automated match to d1gvza_
   complexed with cl, ndg, po4

Details for d2zchp_

PDB Entry: 2zch, 2.83 Å

PDB Description: crystal structure of human prostate specific antigen complexed with an activating antibody

PDB Compounds: (P:) Prostate-specific antigen

SCOPe Domain Sequences for d2zchp_:

Sequence; same for both SEQRES and ATOM records:

>d2zchp_ b.47.1.2 (P:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggwecekhsqpwqvlvasrgravcggvlvhpqwvltaahcirnksvillgrhslfhpe
dtgqvfqvshsfphplydmsllknrflrpgddsshdlmllrlsepaeltdavkvmdlptq
epalgttcyasgwgsiepeefltpkklqcvdlhvisndvcaqvhpqkvtkfmlcagrwtg
gkstcsgdsggplvcngvlqgitswgsepcalperpslytkvvhyrkwikdtivanp

Timeline for d2zchp_:

• d2zchp_ first appeared in SCOPe 2.01
  
• d2zchp_ appears in SCOPe 2.06
  
• d2zchp_ appears in the current release, SCOPe 2.08