Lineage for d2zc7d_ (2zc7 D:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1949285Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1949286Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1949287Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1949998Protein automated matches [190161] (23 species)
    not a true protein
  7. 1950167Species Klebsiella pneumoniae [TaxId:573] [188184] (4 PDB entries)
  8. 1950176Domain d2zc7d_: 2zc7 D: [171154]
    automated match to d1blsa_

Details for d2zc7d_

PDB Entry: 2zc7 (more details), 2.4 Å

PDB Description: Crystal Structure of Class C beta-Lactamase ACT-1
PDB Compounds: (D:) Beta-lactamase ACT-1

SCOPe Domain Sequences for d2zc7d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zc7d_ e.3.1.1 (D:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
pmsekqlaevvertvtplmkaqaipgmavaviyegqphyftfgkadvaankpvtpqtlfe
lgsisktftgvlggdaiargeislgdpvtkywpeltgkqwqgirmldlatytagglplqv
pdevkdnasllrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmsyeqaittrvfkp
lkldhtwinvpkaeeahyawgyrdgkavhvspgmldaeaygvktnvqdmaswvmvnmkpd
slqdnslrkgltlaqsrywrvgamyqglgwemlnwpvdaktvvegsdnkvalaplparev
nppappvnaswvhktgstggfgsyvafipekqlgivmlanksypnparveaayrilsal

SCOPe Domain Coordinates for d2zc7d_:

Click to download the PDB-style file with coordinates for d2zc7d_.
(The format of our PDB-style files is described here.)

Timeline for d2zc7d_: