Lineage for d2zc7b_ (2zc7 B:)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1450060Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1450061Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1450062Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1450662Protein automated matches [190161] (19 species)
    not a true protein
  7. 1450792Species Klebsiella pneumoniae [TaxId:573] [188184] (3 PDB entries)
  8. 1450797Domain d2zc7b_: 2zc7 B: [171152]
    automated match to d1blsa_

Details for d2zc7b_

PDB Entry: 2zc7 (more details), 2.4 Å

PDB Description: Crystal Structure of Class C beta-Lactamase ACT-1
PDB Compounds: (B:) Beta-lactamase ACT-1

SCOPe Domain Sequences for d2zc7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zc7b_ e.3.1.1 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
pmsekqlaevvertvtplmkaqaipgmavaviyegqphyftfgkadvaankpvtpqtlfe
lgsisktftgvlggdaiargeislgdpvtkywpeltgkqwqgirmldlatytagglplqv
pdevkdnasllrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmsyeqaittrvfkp
lkldhtwinvpkaeeahyawgyrdgkavhvspgmldaeaygvktnvqdmaswvmvnmkpd
slqdnslrkgltlaqsrywrvgamyqglgwemlnwpvdaktvvegsdnkvalaplparev
nppappvnaswvhktgstggfgsyvafipekqlgivmlanksypnparveaayrilsal

SCOPe Domain Coordinates for d2zc7b_:

Click to download the PDB-style file with coordinates for d2zc7b_.
(The format of our PDB-style files is described here.)

Timeline for d2zc7b_: