SCOP 1.59: Domain d1lbgb1: 1lbg B:1-60

Lineage for d1lbgb1 (1lbg B:1-60)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families)

5. Family a.35.1.5: Bacterial repressors [47438] (3 proteins)

6. Protein Lac repressor (LacR), N-terminal domain [47441] (1 species)

7. Species Escherichia coli [TaxId:562] [47442] (7 PDB entries)

8. Domain d1lbgb1: 1lbg B:1-60 [17115]
   Other proteins in same PDB: d1lbga2, d1lbgb2, d1lbgc2, d1lbgd2

Details for d1lbgb1

PDB Entry: 1lbg, 4.8 Å

PDB Description: lactose operon repressor bound to 21-base pair symmetric operator dna, alpha carbons only

SCOP Domain Sequences for d1lbgb1:

Sequence; same for both SEQRES and ATOM records:

>d1lbgb1 a.35.1.5 (B:1-60) Lac repressor (LacR), N-terminal domain {Escherichia coli}
mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq

Timeline for d1lbgb1:

• d1lbgb1 first appeared (with stable ids) in SCOP 1.55
  
• d1lbgb1 appears in SCOP 1.57
  
• d1lbgb1 appears in SCOP 1.61
  
• d1lbgb1 appears in the current release, SCOPe 2.08