Lineage for d2zc0d_ (2zc0 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2898112Species Thermococcus litoralis [TaxId:2265] [188474] (1 PDB entry)
  8. 2898116Domain d2zc0d_: 2zc0 D: [171148]
    automated match to d1wsta1
    complexed with imd, pmp, zn

Details for d2zc0d_

PDB Entry: 2zc0 (more details), 2.3 Å

PDB Description: Crystal structure of an archaeal alanine:glyoxylate aminotransferase
PDB Compounds: (D:) Alanine glyoxylate transaminase

SCOPe Domain Sequences for d2zc0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zc0d_ c.67.1.0 (D:) automated matches {Thermococcus litoralis [TaxId: 2265]}
mdytkylagranwikgsaladvmkkaselqkkgvklislaagdpdpelipravlgeiake
vlekepksvmytpangipelreelaaflkkydhlevspenivitiggtgaldllgrvlid
pgdvvitenpsyintllafeqlgakiegvpvdndgmrvdlleekikelkakgqkvkliyt
iptgqnpmgvtmsmerrkalleiaskydlliiedtaynfmryeggdivplkaldnegrvi
vagtlskvlgtgfrigwiiaegeilkkvlmqkqpidfcapaisqyialeylkrgyfekyh
legallgykekrdimlkalenhlpnaeftkpiagmfvmfflpegadgisfanelmeregv
vvvpgkpfytdesgknairlnfsrpskeeipigikklaklykekf

SCOPe Domain Coordinates for d2zc0d_:

Click to download the PDB-style file with coordinates for d2zc0d_.
(The format of our PDB-style files is described here.)

Timeline for d2zc0d_: