![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
![]() | Protein automated matches [190151] (166 species) not a true protein |
![]() | Species Thermococcus litoralis [TaxId:2265] [188474] (1 PDB entry) |
![]() | Domain d2zc0d_: 2zc0 D: [171148] automated match to d1wsta1 complexed with imd, pmp, zn |
PDB Entry: 2zc0 (more details), 2.3 Å
SCOPe Domain Sequences for d2zc0d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zc0d_ c.67.1.0 (D:) automated matches {Thermococcus litoralis [TaxId: 2265]} mdytkylagranwikgsaladvmkkaselqkkgvklislaagdpdpelipravlgeiake vlekepksvmytpangipelreelaaflkkydhlevspenivitiggtgaldllgrvlid pgdvvitenpsyintllafeqlgakiegvpvdndgmrvdlleekikelkakgqkvkliyt iptgqnpmgvtmsmerrkalleiaskydlliiedtaynfmryeggdivplkaldnegrvi vagtlskvlgtgfrigwiiaegeilkkvlmqkqpidfcapaisqyialeylkrgyfekyh legallgykekrdimlkalenhlpnaeftkpiagmfvmfflpegadgisfanelmeregv vvvpgkpfytdesgknairlnfsrpskeeipigikklaklykekf
Timeline for d2zc0d_: