Lineage for d2zbya_ (2zby A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1277465Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1277466Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1278000Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 1278001Protein automated matches [190847] (33 species)
    not a true protein
  7. 1278267Species Streptomyces griseolus [TaxId:1909] [188416] (5 PDB entries)
  8. 1278269Domain d2zbya_: 2zby A: [171143]
    automated match to d1cl6a_
    complexed with hem; mutant

Details for d2zbya_

PDB Entry: 2zby (more details), 1.6 Å

PDB Description: Crystal structure of vitamin D hydroxylase cytochrome P450 105A1 (R84A mutant)
PDB Compounds: (A:) Cytochrome P450-SU1

SCOPe Domain Sequences for d2zbya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zbya_ a.104.1.0 (A:) automated matches {Streptomyces griseolus [TaxId: 1909]}
pqttdapafpsnrscpyqlpdgyaqlrdtpgplhrvtlydgrqawvvtkheaarkllgdp
rlssnrtddnfpatspafeavrespqafigldppehgtrrrmtiseftvkrikgmrpeve
evvhgfldemlaagptadlvsqfalpvpsmvicrllgvpyadheffqdaskrlvqstdaq
saltarndlagyldglitqfqtepgaglvgalvadqlangeidreelistamllliaghe
ttasmtslsvitlldhpeqyaalradrslvpgaveellrylaiadiaggrvatadieveg
qliragegvivvnsianrdgtvyedpdaldihrsarhhlafgfgvhqclgqnlarlelev
ilnalmdrvptlrlavpveqlvlrpgttiqgvnelpvtwh

SCOPe Domain Coordinates for d2zbya_:

Click to download the PDB-style file with coordinates for d2zbya_.
(The format of our PDB-style files is described here.)

Timeline for d2zbya_: