Class a: All alpha proteins [46456] (284 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (10 species) not a true protein |
Species Streptomyces griseolus [TaxId:1909] [188416] (5 PDB entries) |
Domain d2zbya_: 2zby A: [171143] automated match to d1cl6a_ complexed with hem; mutant |
PDB Entry: 2zby (more details), 1.6 Å
SCOPe Domain Sequences for d2zbya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zbya_ a.104.1.0 (A:) automated matches {Streptomyces griseolus [TaxId: 1909]} pqttdapafpsnrscpyqlpdgyaqlrdtpgplhrvtlydgrqawvvtkheaarkllgdp rlssnrtddnfpatspafeavrespqafigldppehgtrrrmtiseftvkrikgmrpeve evvhgfldemlaagptadlvsqfalpvpsmvicrllgvpyadheffqdaskrlvqstdaq saltarndlagyldglitqfqtepgaglvgalvadqlangeidreelistamllliaghe ttasmtslsvitlldhpeqyaalradrslvpgaveellrylaiadiaggrvatadieveg qliragegvivvnsianrdgtvyedpdaldihrsarhhlafgfgvhqclgqnlarlelev ilnalmdrvptlrlavpveqlvlrpgttiqgvnelpvtwh
Timeline for d2zbya_: