Lineage for d2zbxa_ (2zbx A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1277465Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1277466Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1278000Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 1278001Protein automated matches [190847] (33 species)
    not a true protein
  7. 1278267Species Streptomyces griseolus [TaxId:1909] [188416] (5 PDB entries)
  8. 1278268Domain d2zbxa_: 2zbx A: [171142]
    automated match to d1cl6a_
    complexed with hem, imd

Details for d2zbxa_

PDB Entry: 2zbx (more details), 1.5 Å

PDB Description: Crystal structure of vitamin D hydroxylase cytochrome P450 105A1 (wild type) with imidazole bound
PDB Compounds: (A:) Cytochrome P450-SU1

SCOPe Domain Sequences for d2zbxa_:

Sequence, based on SEQRES records: (download)

>d2zbxa_ a.104.1.0 (A:) automated matches {Streptomyces griseolus [TaxId: 1909]}
pqttdapafpsnrscpyqlpdgyaqlrdtpgplhrvtlydgrqawvvtkheaarkllgdp
rlssnrtddnfpatsprfeavrespqafigldppehgtrrrmtiseftvkrikgmrpeve
evvhgfldemlaagptadlvsqfalpvpsmvicrllgvpyadheffqdaskrlvqstdaq
saltarndlagyldglitqfqtepgaglvgalvadqlangeidreelistamllliaghe
ttasmtslsvitlldhpeqyaalradrslvpgaveellrylaiadiaggrvatadieveg
qliragegvivvnsianrdgtvyedpdaldihrsarhhlafgfgvhqclgqnlarlelev
ilnalmdrvptlrlavpveqlvlrpgttiqgvnelpvtwhhhh

Sequence, based on observed residues (ATOM records): (download)

>d2zbxa_ a.104.1.0 (A:) automated matches {Streptomyces griseolus [TaxId: 1909]}
pqttdapafpsnrscpyqlpdgyaqlrdtpgplhrvtlydgrqawvvtkheaarkllgdp
rlssnrtddnfpatsprfespqafigldppehgtrrrmtiseftvkrikgmrpeveevvh
gfldemlaagptadlvsqfalpvpsmvicrllgvpyadheffqdaskrlvqstdaqsalt
arndlagyldglitqfqtepgaglvgalvadqlangeidreelistamllliaghettas
mtslsvitlldhpeqyaalradrslvpgaveellrylaiadiaggrvatadievegqlir
agegvivvnsianrdgtvyedpdaldihrsarhhlafgfgvhqclgqnlarlelevilna
lmdrvptlrlavpveqlvlrpgttiqgvnelpvtwhhhh

SCOPe Domain Coordinates for d2zbxa_:

Click to download the PDB-style file with coordinates for d2zbxa_.
(The format of our PDB-style files is described here.)

Timeline for d2zbxa_: