Lineage for d2zbxa1 (2zbx A:8-406)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005902Species Streptomyces griseolus [TaxId:1909] [188416] (6 PDB entries)
  8. 2005903Domain d2zbxa1: 2zbx A:8-406 [171142]
    Other proteins in same PDB: d2zbxa2
    automated match to d1cl6a_
    complexed with hem, imd

Details for d2zbxa1

PDB Entry: 2zbx (more details), 1.5 Å

PDB Description: Crystal structure of vitamin D hydroxylase cytochrome P450 105A1 (wild type) with imidazole bound
PDB Compounds: (A:) Cytochrome P450-SU1

SCOPe Domain Sequences for d2zbxa1:

Sequence, based on SEQRES records: (download)

>d2zbxa1 a.104.1.0 (A:8-406) automated matches {Streptomyces griseolus [TaxId: 1909]}
pqttdapafpsnrscpyqlpdgyaqlrdtpgplhrvtlydgrqawvvtkheaarkllgdp
rlssnrtddnfpatsprfeavrespqafigldppehgtrrrmtiseftvkrikgmrpeve
evvhgfldemlaagptadlvsqfalpvpsmvicrllgvpyadheffqdaskrlvqstdaq
saltarndlagyldglitqfqtepgaglvgalvadqlangeidreelistamllliaghe
ttasmtslsvitlldhpeqyaalradrslvpgaveellrylaiadiaggrvatadieveg
qliragegvivvnsianrdgtvyedpdaldihrsarhhlafgfgvhqclgqnlarlelev
ilnalmdrvptlrlavpveqlvlrpgttiqgvnelpvtw

Sequence, based on observed residues (ATOM records): (download)

>d2zbxa1 a.104.1.0 (A:8-406) automated matches {Streptomyces griseolus [TaxId: 1909]}
pqttdapafpsnrscpyqlpdgyaqlrdtpgplhrvtlydgrqawvvtkheaarkllgdp
rlssnrtddnfpatsprfespqafigldppehgtrrrmtiseftvkrikgmrpeveevvh
gfldemlaagptadlvsqfalpvpsmvicrllgvpyadheffqdaskrlvqstdaqsalt
arndlagyldglitqfqtepgaglvgalvadqlangeidreelistamllliaghettas
mtslsvitlldhpeqyaalradrslvpgaveellrylaiadiaggrvatadievegqlir
agegvivvnsianrdgtvyedpdaldihrsarhhlafgfgvhqclgqnlarlelevilna
lmdrvptlrlavpveqlvlrpgttiqgvnelpvtw

SCOPe Domain Coordinates for d2zbxa1:

Click to download the PDB-style file with coordinates for d2zbxa1.
(The format of our PDB-style files is described here.)

Timeline for d2zbxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zbxa2