Lineage for d2zboi_ (2zbo I:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2691317Protein automated matches [190113] (17 species)
    not a true protein
  7. 2691328Species Hizikia fusiformis [TaxId:74103] [188620] (1 PDB entry)
  8. 2691333Domain d2zboi_: 2zbo I: [171140]
    automated match to d1gdva_
    complexed with hem, so4

Details for d2zboi_

PDB Entry: 2zbo (more details), 1.6 Å

PDB Description: Crystal structure of low-redox-potential cytochrom c6 from brown alga Hizikia fusiformis at 1.6 A resolution
PDB Compounds: (I:) cytochrome c6

SCOPe Domain Sequences for d2zboi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zboi_ a.3.1.1 (I:) automated matches {Hizikia fusiformis [TaxId: 74103]}
adinhgenvftancsachaggnnvimpektlqkdalstnqmnsvgaityqvtngknampa
fggrlsdddiedvasfvlsqsekswn

SCOPe Domain Coordinates for d2zboi_:

Click to download the PDB-style file with coordinates for d2zboi_.
(The format of our PDB-style files is described here.)

Timeline for d2zboi_: