Lineage for d1lbga1 (1lbg A:1-60)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2993Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
  4. 2994Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families) (S)
  5. 3087Family a.35.1.5: Bacterial repressors [47438] (3 proteins)
  6. 3092Protein Lac repressor (LacR), N-terminal domain [47441] (1 species)
  7. 3093Species Escherichia coli [TaxId:562] [47442] (6 PDB entries)
  8. 3102Domain d1lbga1: 1lbg A:1-60 [17114]
    Other proteins in same PDB: d1lbga2, d1lbgb2, d1lbgc2, d1lbgd2

Details for d1lbga1

PDB Entry: 1lbg (more details), 4.8 Å

PDB Description: lactose operon repressor bound to 21-base pair symmetric operator dna, alpha carbons only

SCOP Domain Sequences for d1lbga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lbga1 a.35.1.5 (A:1-60) Lac repressor (LacR), N-terminal domain {Escherichia coli}
mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq

SCOP Domain Coordinates for d1lbga1:

Click to download the PDB-style file with coordinates for d1lbga1.
(The format of our PDB-style files is described here.)

Timeline for d1lbga1:

3102
d1lbga1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1lbga2