SCOPe 2.04: Domain d2zboe_: 2zbo E:

Lineage for d2zboe_ (2zbo E:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein automated matches [190113] (15 species)
   not a true protein

7. Species Hizikia fusiformis [TaxId:74103] [188620] (1 PDB entry)

8. Domain d2zboe_: 2zbo E: [171138]
   automated match to d1gdva_
   complexed with hem, so4

Details for d2zboe_

PDB Entry: 2zbo, 1.6 Å

PDB Description: Crystal structure of low-redox-potential cytochrom c6 from brown alga Hizikia fusiformis at 1.6 A resolution

PDB Compounds: (E:) cytochrome c6

SCOPe Domain Sequences for d2zboe_:

Sequence; same for both SEQRES and ATOM records:

>d2zboe_ a.3.1.1 (E:) automated matches {Hizikia fusiformis [TaxId: 74103]}
adinhgenvftancsachaggnnvimpektlqkdalstnqmnsvgaityqvtngknampa
fggrlsdddiedvasfvlsqsekswn

Timeline for d2zboe_:

• d2zboe_ first appeared in SCOPe 2.01
  
• d2zboe_ appears in SCOPe 2.03
  
• d2zboe_ appears in SCOPe 2.05
  
• d2zboe_ appears in the current release, SCOPe 2.08