![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
![]() | Protein automated matches [190113] (17 species) not a true protein |
![]() | Species Hizikia fusiformis [TaxId:74103] [188620] (1 PDB entry) |
![]() | Domain d2zboc_: 2zbo C: [171137] automated match to d1gdva_ complexed with hem, so4 |
PDB Entry: 2zbo (more details), 1.6 Å
SCOPe Domain Sequences for d2zboc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zboc_ a.3.1.1 (C:) automated matches {Hizikia fusiformis [TaxId: 74103]} adinhgenvftancsachaggnnvimpektlqkdalstnqmnsvgaityqvtngknampa fggrlsdddiedvasfvlsqsekswn
Timeline for d2zboc_: